PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn165731
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 272aa    MW: 30490.5 Da    PI: 4.5822
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn165731genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-142469146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g W++eEde+l ++  + G g+W+ +ar  g+ Rt++++k++w++
       Achn165731 24 KGLWSPEEDERLMKYMMRNGQGSWSDVARNAGLERTDNEIKNFWNS 69
                     678*****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-181777IPR009057Homeodomain-like
SuperFamilySSF466898.97E-141979IPR009057Homeodomain-like
PROSITE profilePS5129420.031975IPR017930Myb domain
SMARTSM007175.3E-102373IPR001005SANT/Myb domain
PfamPF002491.3E-122469IPR001005SANT/Myb domain
CDDcd001671.26E-82768No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MRKPETIMDK DKLNNNNTKN KLRKGLWSPE EDERLMKYMM RNGQGSWSDV ARNAGLERTD  60
NEIKNFWNSS IKKKLKNYNN SNSNSNSNSE SSPNNSDVSS EPRNVMAAGI MYVQDHDNIA  120
PLCMDSSSSS SSSSFHANRF NPFPLLENNF DLMNTTDLFD FSICLPQGGI REGHLGDYGN  180
FEGGGMGLES DHTLVPLQDN RGFMVNNNIG GNDYENFGNK INTNNFHNGE GIQVEDMFGV  240
GNHWQGENLK MGEWDLESLL ENVASFPCID F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047407.11e-68PREDICTED: transcription factor MYB46-like
TrEMBLA0A0E4B8Y55e-67A0A0E4B8Y5_9R
STRINGPOPTR_0009s06630.14e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-14myb domain protein 46